Close
Xvideos
Kemono
4Chan
Games
Tags
Home
Manga
Video
Hanime
Fapello
Favorites

13611240288

absurd_resall_foursanalanal_sexanthroballsbiohazard_symbolblack_bodyblushbodily_fluidsbreastscat_sharkcatsharkcumdialoguedoggy_styledomestic_catdominantdominant_femaleduoenglish_texterectionfartfart_cloudfart_fetishfart_maskfart_sniffingfart_tubesfarting_in_maskfarting_on_anotherfelidfelinefelisfemalefemale_penetratingfemale_penetrating_malefinfishfrom_behind_positionfurgas_maskgassinggenital_fluidsgenitalsgood_boygreen_eyesgwen_(sharkskunk)hairhazard_symbolhi_reshumanoid_genitaliahumanoid_penishybridjuniper_(sharkskunk)looking_pleasuredmalemale/femalemale_penetratedmammalmarinemaskmephitidnipplesnudeobject_in_assopen_mouthorgasmpastiespeggingpenetrationpenilepenispostersexsex_toysex_toy_in_asssex_toy_insertionsex_toy_penetrationsharksharkskunkskunksmellysmilesmirksniffingspeech_bubblestomach_bulgestraponsubmissivesubmissive_malesymboltailteasingteethtextthick_thighstoying_partner





absurd_res all_fours anal anal_sex anthro balls biohazard_symbol black_body blush bodily_fluids breasts cat_shark catshark cum dialogue doggy_style domestic_cat dominant dominant_female duo english_text erection fart fart_cloud fart_fetish fart_mask fart_sniffing fart_tubes farting_in_mask farting_on_another felid feline felis female female_penetrating female_penetrating_male fin fish from_behind_position fur gas_mask gassing genital_fluids genitals good_boy green_eyes gwen_(sharkskunk) hair hazard_symbol hi_res humanoid_genitalia humanoid_penis hybrid juniper_(sharkskunk) looking_pleasured male male/female male_penetrated mammal marine mask mephitid nipples nude object_in_ass open_mouth orgasm pasties pegging penetration penile penis poster sex sex_toy sex_toy_in_ass sex_toy_insertion sex_toy_penetration shark sharkskunk skunk smelly smile smirk sniffing speech_bubble stomach_bulge strapon submissive submissive_male symbol tail teasing teeth text thick_thighs toying_partner
absurd_res all_fours anal anal_sex anthro balls biohazard_symbol black_body blush bodily_fluids breasts cat_shark catshark dialogue doggy_style domestic_cat dominant dominant_female duo english_text erection fart fart_cloud fart_fetish fart_mask fart_sniffing fart_tubes farting_in_mask farting_on_another felid feline felis female female_penetrating female_penetrating_male fin fish from_behind_position fur gas_mask genital_fluids genitals green_eyes gwen_(sharkskunk) hair hazard_symbol hi_res hybrid juniper_(sharkskunk) looking_pleasured male male/female male_penetrated mammal marine mask mephitid nipples nude object_in_ass pasties pegging penetration penis poster sex sex_toy sex_toy_in_ass sex_toy_insertion sex_toy_penetration shark sharkskunk skunk smelly smile smirk sniffing speech_bubble stomach_bulge strapon submissive submissive_male symbol tail teeth text thick_thighs toying_partner
absurd_res anal anthro asphyxiation bed bedroom catshark comic controller dialogue dominant dominant_male duo electronics english_text fart fart_cloud fart_exiting_nose fart_fetish fart_sniffing fart_torture farting_in_mouth farting_on_another farting_on_face felid feline fish furniture gassing gwen_(sharkskunk) hair hi_res hybrid internal male male/male mammal marine mephitid onomatopoeia oral pasties phone pink_hair purple_body remote_control rimming rimming_male sequence sex shaded shark sharkskunk skunk smelly smile smirk sniffing sound_effects speech_bubble stink_cloud stink_fumes stink_lines stinkbomb_(stinkbombskunk) teasing text

Quick Navigation

  • Home
  • Trending Content
  • Categories
  • Artists
  • Popular Tags
  • Advanced Search

About Rule34.dev

Rule34.dev is the premier aggregation platform for adult anime, manga, and game artwork. Our comprehensive database indexes content from all major boorus and artist platforms, providing the most extensive collection of hentai artwork available online with powerful search capabilities and a user-friendly interface.

© 2025 Rule34.dev - The ultimate anime, manga, and game adult content aggregator. All rights reserved.

All content indexed is hosted by respective sources. Rule34.dev is an indexing service and does not host content directly.

This site contains adult content and is intended for viewers aged 18+ only.